Expreience The BEST

4.67 Rating by ClearWebStats
mobilegyan.com is 5 years 8 months 4 weeks old. This website has a #7,137,746 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, mobilegyan.com is SAFE to browse.
Get Custom Widget

Traffic Report of Mobilegyan

Daily Unique Visitors: 67
Daily Pageviews: 134

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 7,137,746
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View mobilegyan.com site advisor rating Not Applicable

Where is mobilegyan.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with mobilegyan.com

Hosted Country:

mobilegyan.com hosted country US mobilegyan.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View mobilegyan.com HTML resources

Homepage Links Analysis

MOBILE GYAN - Expreience The BEST

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 10
H3 Headings: 12 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 21
Google Adsense: Not Applicable Google Analytics: UA-124847475-1

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

mobilegyan.com favicon - jenniferchemsales.com

View mobilegyan.com Pagerank   mobilegyan.com alexa rank Not Applicable   mobilegyan.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

mobilegyan.com favicon - shrivishwakarmasafetytraininginstitute.com

View mobilegyan.com Pagerank   mobilegyan.com alexa rank Not Applicable   mobilegyan.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

mobilegyan.com favicon - theshineenglishacademy.com

View mobilegyan.com Pagerank   mobilegyan.com alexa rank Not Applicable   mobilegyan.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

mobilegyan.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View mobilegyan.com Pagerank   mobilegyan.com alexa rank Not Applicable   mobilegyan.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

mobilegyan.com favicon - 247bestpillpharma.com

View mobilegyan.com Pagerank   mobilegyan.com alexa rank Not Applicable   mobilegyan.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 05 Aug 2020 18:29:07 GMT
Server: Apache
Link: <http://mobilegyan.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for mobilegyan.com

Domain Registrar: Dreamscape Networks International Pte Ltd mobilegyan.com registrar info
Registration Date: 2018-07-30 5 years 8 months 4 weeks ago
Last Modified: 2020-07-31 3 years 8 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns801.globehost.org mobilegyan.com name server information 162.241.148.33 mobilegyan.com server is located in United States United States
ns802.globehost.org mobilegyan.com name server information 162.241.148.33 mobilegyan.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
mobilegyan.com A 14400 IP:162.241.148.33
mobilegyan.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
mobilegyan.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
mobilegyan.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2020061201
Refresh:3600
Retry:7200
Expire:1209600
mobilegyan.com MX 14400 Target:mobilegyan.com
mobilegyan.com TXT 14400 TXT:v=spf1 ip4:162.241.148.33 +a +mx
+ip4:148.72.152.24 ~all

Similarly Ranked Websites to Mobilegyan

HOME - ACA Distributor Sterno Jelly, Sterno Pasta, Sterno Gel

mobilegyan.com favicon - arkasterno.com

CV. ARKA CIPTA ABADI adalah Distributor sterno jelly, sterno pasta, bahan pemanas makanan yang banyak di gunakan di restoran, Hotel dan Catering

View mobilegyan.com Pagerank   Alexa rank for mobilegyan.com 7,137,749   website value of mobilegyan.com $ 8.95

Home - Main Electric LLC In Spring Hill Florida

mobilegyan.com favicon - mainelectricllc.com

Main Electric LLC Home Page. Main Electric LLC is a licensed, insured, and bonded electrical contractor in Spring Hill, FL

View mobilegyan.com Pagerank   Alexa rank for mobilegyan.com 7,137,752   website value of mobilegyan.com $ 8.95

繝輔Ο繧「繝シ繧ウ繝シ繝

mobilegyan.com favicon - burnish-club.com

View mobilegyan.com Pagerank   Alexa rank for mobilegyan.com 7,137,755   website value of mobilegyan.com $ 8.95

Virgin Tube

mobilegyan.com favicon - virgintube.org

View mobilegyan.com Pagerank   Alexa rank for mobilegyan.com 7,137,763   website value of mobilegyan.com $ 8.95

Backpage Alternatives and Adult Classifieds in 2020

mobilegyan.com favicon - bestbackpagealternatives.com

Backpage alternatives and adult classifieds are popular since backpage went down, we provide information on the best ones!

View mobilegyan.com Pagerank   Alexa rank for mobilegyan.com 7,137,782   website value of mobilegyan.com $ 8.95

Full WHOIS Lookup for mobilegyan.com

Domain Name: MOBILEGYAN.COM
Registry Domain ID: 2291741177_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com.au
Updated Date: 2020-07-31T04:35:37Z
Creation Date: 2018-07-30T16:28:38Z
Registry Expiry Date: 2022-07-30T16:28:38Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS801.GLOBEHOST.ORG
Name Server: NS802.GLOBEHOST.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-05T18:29:05Z