Web stats for Mobilegyan - mobilegyan.com
Expreience The BEST
4.67 Rating by ClearWebStats
mobilegyan.com is 5 years 9 months 1 week old. This website has a #7,137,746 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, mobilegyan.com is SAFE to browse.
Traffic Report of Mobilegyan
Daily Unique Visitors: | 67 |
Daily Pageviews: | 134 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 7,137,746 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is mobilegyan.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 10 |
H3 Headings: | 12 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 21 |
Google Adsense: | Not Applicable | Google Analytics: | UA-124847475-1 |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Wed, 05 Aug 2020 18:29:07 GMT
Server: Apache
Link: <http://mobilegyan.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Wed, 05 Aug 2020 18:29:07 GMT
Server: Apache
Link: <http://mobilegyan.com/wp-json/>; rel="https://api.w.org/"
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information for mobilegyan.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
mobilegyan.com | A | 14400 |
IP:162.241.148.33 |
mobilegyan.com | NS | 86400 |
Target:ns2.bh-ht-17.webhostbox.net |
mobilegyan.com | NS | 86400 |
Target:ns1.bh-ht-17.webhostbox.net |
mobilegyan.com | SOA | 86400 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:cpanel.webhostbox.net Serial:2020061201 Refresh:3600 Retry:7200 Expire:1209600 |
mobilegyan.com | MX | 14400 |
Target:mobilegyan.com |
mobilegyan.com | TXT | 14400 |
TXT:v=spf1 ip4:162.241.148.33 +a +mx +ip4:148.72.152.24 ~all |
Similarly Ranked Websites to Mobilegyan
HOME - ACA Distributor Sterno Jelly, Sterno Pasta, Sterno Gel
- arkasterno.com
CV. ARKA CIPTA ABADI adalah Distributor sterno jelly, sterno pasta, bahan pemanas makanan yang banyak di gunakan di restoran, Hotel dan Catering
Home - Main Electric LLC In Spring Hill Florida
- mainelectricllc.com
Main Electric LLC Home Page. Main Electric LLC is a licensed, insured, and bonded electrical contractor in Spring Hill, FL
Backpage Alternatives and Adult Classifieds in 2020
- bestbackpagealternatives.com
Backpage alternatives and adult classifieds are popular since backpage went down, we provide information on the best ones!
Full WHOIS Lookup for mobilegyan.com
Domain Name: MOBILEGYAN.COM
Registry Domain ID: 2291741177_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com.au
Updated Date: 2020-07-31T04:35:37Z
Creation Date: 2018-07-30T16:28:38Z
Registry Expiry Date: 2022-07-30T16:28:38Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS801.GLOBEHOST.ORG
Name Server: NS802.GLOBEHOST.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-05T18:29:05Z
Registry Domain ID: 2291741177_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.crazydomains.com
Registrar URL: http://www.crazydomains.com.au
Updated Date: 2020-07-31T04:35:37Z
Creation Date: 2018-07-30T16:28:38Z
Registry Expiry Date: 2022-07-30T16:28:38Z
Registrar: Dreamscape Networks International Pte Ltd
Registrar IANA ID: 1291
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +61 894 220 890
Domain Status: ok https://icann.org/epp#ok
Name Server: NS801.GLOBEHOST.ORG
Name Server: NS802.GLOBEHOST.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-05T18:29:05Z